PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G17320.1
Common NameHDG9, HDGL2-9, MKP11.28
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 718aa    MW: 81068.1 Da    PI: 7.6263
Description homeodomain GLABROUS 9
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G17320.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.72e-182782156
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                 ++  +++t+eq+++Le++F+++++p++ +r+ L ++l+L+ +q+k+WFqN+R++ k
  AT5G17320.1 27 KKGYHRHTNEQIHRLETYFKECPHPDEFQRRLLGEELNLKPKQIKFWFQNKRTQAK 82
                 5778899**********************************************988 PP

2START100.92.3e-322434613206
                  HHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECTT CS
        START   3 aeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetla....kaetlevissg 88 
                  ae+a  e++++++ ++ +W+kss         ++++++ +++ +   + + e +++++vv m++ +l  ++l    +W + ++    +a+t+ v++s 
  AT5G17320.1 243 AEKAVSEVLSLIQMDDTMWKKSSiddrlvidPGLYEKYFTKTNTN--G-RPESSKDVVVVQMDAGNLIDIFLTAE-KWARLFPtivnEAKTIHVLDSV 336
                  789999********************9999555555555555544..4.67**************9999999999.99999999999*********98 PP

                  .....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXX..H CS
        START  89 .....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlp..h 178
                       ++  +++ +l  lsplvp R+f+++R+++q ++ +w+i+dvS   ++    + s+  ++++pSg li+ ++ g skvtw+ehv ++++ +  h
  AT5G17320.1 337 dhrgkTFSRVIYEQLHILSPLVPpREFMILRTCQQIEDNVWMIADVSCHLPNIEF-DLSFPICTKRPSGVLIQALPHGFSKVTWIEHVVVNDNRVrpH 433
                  8999*999999*************************************9999987.9***********************************99888* PP

                  HHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
        START 179 wllrslvksglaegaktwvatlqrqcek 206
                   l+r l+  g   ga++w+ tl+r ce+
  AT5G17320.1 434 KLYRDLLYGGFGYGARRWTVTLERTCER 461
                  **************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.09E-172085IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-182190IPR009057Homeodomain-like
PROSITE profilePS5007115.7912484IPR001356Homeobox domain
SMARTSM003891.6E-162688IPR001356Homeobox domain
PfamPF000468.5E-162782IPR001356Homeobox domain
CDDcd000863.52E-162785No hitNo description
PROSITE profilePS5084839.232232464IPR002913START domain
SuperFamilySSF559611.92E-26235461No hitNo description
CDDcd088751.53E-79239460No hitNo description
Gene3DG3DSA:3.30.530.201.8E-7240420IPR023393START-like domain
SMARTSM002343.7E-14241461IPR002913START domain
PfamPF018522.1E-26243461IPR002913START domain
SuperFamilySSF559615.86E-7517709No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0009071anatomyanther wall tapetum
PO:0025074anatomyembryo sac
PO:0025281anatomypollen
Sequence ? help Back to Top
Protein Sequence    Length: 718 aa     Download sequence    Send to blast
MDFTRDDNSS DERENDVDAN TNNRHEKKGY HRHTNEQIHR LETYFKECPH PDEFQRRLLG  60
EELNLKPKQI KFWFQNKRTQ AKSHNEKADN AALRAENIKI RRENESMEDA LNNVVCPPCG  120
GRGPGREDQL RHLQKLRAQN AYLKDEYERV SNYLKQYGGH SMHNVEATPY LHGPSNHAST  180
SKNRPALYGT SSNRLPEPSS IFRGPYTRGN MNTTAPPQPR KPLEMQNFQP LSQLEKIAML  240
EAAEKAVSEV LSLIQMDDTM WKKSSIDDRL VIDPGLYEKY FTKTNTNGRP ESSKDVVVVQ  300
MDAGNLIDIF LTAEKWARLF PTIVNEAKTI HVLDSVDHRG KTFSRVIYEQ LHILSPLVPP  360
REFMILRTCQ QIEDNVWMIA DVSCHLPNIE FDLSFPICTK RPSGVLIQAL PHGFSKVTWI  420
EHVVVNDNRV RPHKLYRDLL YGGFGYGARR WTVTLERTCE RLIFSTSVPA LPNNDNPGVV  480
QTIRGRNSVM HLGERMLRNF AWMMKMVNKL DFSPQSETNN SGIRIGVRIN NEAGQPPGLI  540
VCAGSSLSLP LPPVQVYDFL KNLEVRHQWD VLCHGNPATE AARFVTGSNP RNTVSFLEPS  600
IRDINTKLMI LQDSFKDALG GMVAYAPMDL NTACAAISGD IDPTTIPILP SGFMISRDGR  660
PSEGEAEGGS YTLLTVAFQI LVSGPSYSPD TNLEVSATTV NTLISSTVQR IKAMLKCE
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184182630.0
Genevisible250089_at0.0
Expression AtlasAT5G17320-
AtGenExpressAT5G17320-
ATTED-IIAT5G17320-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in anthers with highest levels in the tapetum and pollen grains, and chalazal end of the embryo sac. {ECO:0000269|PubMed:16778018}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeobox-leucine zipper family protein belonging to the HD-ZIP IV family.
UniProtProbable transcription factor that binds to the DNA sequence 5'-GCATTAAATGCGCA-3'. {ECO:0000269|PubMed:16778018}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G17320.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G17320
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0052380.0AB005238.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MKP11.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_197234.10.0homeobox-leucine zipper protein HDG9
SwissprotQ9FFI00.0HDG9_ARATH; Homeobox-leucine zipper protein HDG9
TrEMBLR0H7P30.0R0H7P3_9BRAS; Uncharacterized protein
STRINGAT5G17320.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM84681531
Representative plantOGRP14515136
Publications ? help Back to Top
  1. Tavares R,Aubourg S,Lecharny A,Kreis M
    Organization and structural evolution of four multigene families in Arabidopsis thaliana: AtLCAD, AtLGT, AtMYST and AtHD-GL2.
    Plant Mol. Biol., 2000. 42(5): p. 703-17
    [PMID:10809443]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Schrick K,Nguyen D,Karlowski WM,Mayer KF
    START lipid/sterol-binding domains are amplified in plants and are predominantly associated with homeodomain transcription factors.
    Genome Biol., 2004. 5(6): p. R41
    [PMID:15186492]
  4. Nakamura M, et al.
    Characterization of the class IV homeodomain-Leucine Zipper gene family in Arabidopsis.
    Plant Physiol., 2006. 141(4): p. 1363-75
    [PMID:16778018]
  5. Kawanabe T,Fujimoto R,Sasaki T,Taylor JM,Dennis ES
    A comparison of transcriptome and epigenetic status between closely related species in the genus Arabidopsis.
    Gene, 2012. 506(2): p. 301-9
    [PMID:22796129]